PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM71970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 294aa    MW: 32877.1 Da    PI: 6.8478
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM71970.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.8e-082422752154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  OWM71970.1 242 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 275
                 469*****************************87 PP

2ELK25.14e-09196217122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  OWM71970.1 196 ELKIELKQGFRSKIEDVREEIL 217
                 9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    
MMGGGRGGGG GIGGLAAGEG TVSAADLQKL KAEIATHPLY EQLMSAHVAC LREATPIDQL  60
PLIDAQLAQA HHLLRSYAAA AQQQHSLSPH DRQELDNFLA QYLIVLCSFK EQLQQHVRVH  120
AVEAVMACRE IENNLHALTG ATLGEGTGAT MSDDEDDLQM DYSLDQSGAE GHDMMGFGPL  180
LPTESERSLM ERVRQELKIE LKQGFRSKIE DVREEILRKR RAGKLPGDTT SVLKNWWQQH  240
SKWPYPTEDD KAKLVEETGL QLKQINNWFI NQRKRNWHNN SSHSVTSLKS KRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311GGGRGGGGG
2412GGGRGGGGG
3273294RKRNWHNNSSHSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-158TALE family protein