PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM70783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 164aa    MW: 18974.3 Da    PI: 6.0316
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM70783.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.6e-10901252055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  OWM70783.1  90 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 125
                 5679*****************************985 PP

2ELK37.55.1e-134566122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK++Ll+KYsgyL+sLkqE+s
  OWM70783.1 45 ELKNHLLKKYSGYLSSLKQELS 66
                9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    
MEMLTSDFIS IDEKGEGAGS SEDDQDNSGG ETDLPEIDPR AEDRELKNHL LKKYSGYLSS  60
LKQELSKKKK KGKLPKEARQ KLLSWWELHY KWPYPSETEK VALAESTGLD QKQINNWFIN  120
QRKRHWKPSE DMQFMVMDGL HPQNAAALYI DSHYMSDGPY RLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-71TALE family protein