PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM68909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 711aa    MW: 78473.7 Da    PI: 7.015
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM68909.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095275641954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  OWM68909.1 527 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 564
                 564459******************************88 PP

2BELL103.91.1e-33386454472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e q+k+a Ll +++eV++rYkqy++q+q+v+ssFe+vagl +a+pY+slAlk+++r+FrcLk ai +q+
  OWM68909.1 386 EDQQKRATLLFMQDEVCRRYKQYHQQMQMVVSSFETVAGLSAATPYISLALKTVARNFRCLKSAIFDQL 454
                 6799**************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    
MEMHPPRPES HVAQSSRRDK LRVAAGHHLD EFPGHLGQRM VYSGLMLPSN AVDSPSHSNA  60
AQLIHRDGTL HQLTAGVSPS NQLVVSEDAS FRLYGGDPHH IDGLRRPSLH YSIDWAAYHS  120
SGSTNEDNQN PMYVREVLSA DLKASNTLSA PVHYLAKNDT LNRYRDPSIE ISSQDSQHGN  180
VDGFPSKCYQ ETLLEVVSSA AVASGLNAGN ELALLPTYGR ELNALNCSNV VAWNNNPAEI  240
SCHRGISSDT NAQGLSLTLS SNPSSSMLMI RNDQDPEAFS SGYSNAVTRP SVIGKKSGKA  300
LHEITGVSTC SVQWSTGPLG PFTGYATILK CSKFLKPAQD LLEELCRVTW PKPVEMRIML  360
ERISEESCMS SSSGGGSSSS TNFPSEDQQK RATLLFMQDE VCRRYKQYHQ QMQMVVSSFE  420
TVAGLSAATP YISLALKTVA RNFRCLKSAI FDQLRTLKKS SGDDYLSPNT SAKGDLNSSK  480
MTNSSQNFTR SRYFGANMSF LDAPHHVWRP QRGLPERAVA ILRAWLFEHF LHPYPTDTDK  540
HMLATQTGLS RNQVSNWFIN ARVRLWKPMV EEIHALETKR LGEANPNSAP NREASCVEVS  600
SQREAMDHQP SSSGRVDHHM ASAAVEERIQ CSGDGLNAEQ WNQEFRSRLE GQLPVSSEGP  660
LIGFMRYPQG GMEFGGIGAV SLSLGLRHNA QRQDDELRQQ FGGAMMRDFV D
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.11e-84TALE family protein