PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM67166.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family TALE
Protein Properties Length: 643aa    MW: 70086.7 Da    PI: 6.8166
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM67166.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-094334701954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  OWM67166.1 433 FEHflHPYPTDTDKIMLAKQTGLSRSQVSNWFINARVR 470
                 554459******************************88 PP

2BELL108.83.3e-35302370472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 ++++kk++L+s+leeV++rYkqy++q+q v++sFe vag g+a+pY++lAlka+S+hFrcLk ai++q+
  OWM67166.1 302 DVRRKKSRLISMLEEVCRRYKQYYQQMQDVVASFEYVAGFGNAAPYANLALKAMSKHFRCLKSAITDQL 370
                 7899**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    
MAEGFEQYHV PQQSRRDKLR VGAGAGAEPT SASLHGLLPH YDPSLLPSDL LSCAAATSTD  60
HGFHSHHLHP LATAEDGGGC KSHSVHSLVK EEGGCRSLIP PSSSSSSSTH HHQLYGLDPP  120
PQLAVNPSCS ATIHDLGSNS AFLYAPQTLQ NLRDFAHSYN NTLSLSLSSH DNHADNNRPN  180
DNLSLPLELN LQRYGSNAAS AGGYLIPAAV SVGGGLASNE VSRSSVPLGP FTGYSSILKG  240
SRFLRPAQQL LEELCDVGRT GPVEKIGEAD SSLVVDASAL EGYLSVEDSG SSLSSCGGDA  300
GDVRRKKSRL ISMLEEVCRR YKQYYQQMQD VVASFEYVAG FGNAAPYANL ALKAMSKHFR  360
CLKSAITDQL QLNKEQGNPG RDDGYPRLGS KDGVSYGQRP LSSSGYFDHH QPVWRPQRGL  420
PERAVTVLRA WLFEHFLHPY PTDTDKIMLA KQTGLSRSQV SNWFINARVR LWKPMVEEIH  480
MLETQQAQKA SNSQREDGNA DNNSSRPVDH QLPMASETPS TSSQRVHEPL SNKRTRSDLP  540
EFPMRNDSER PHHLSYDPST HPHHVSVGEG IRGLNNSVSL TLGLRQNNNG MSLPEAFQVN  600
AVQRFGLGLE GSSEGFVLSG YEGQDRQFGR DVYGGQLLHD FVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-107TALE family protein