PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g971200.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family E2F/DP
Protein Properties Length: 754aa    MW: 89915.5 Da    PI: 7.8663
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g971200.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP52.58e-176807262371
           E2F_TDP  23 givtlnevakeLvsedvknkrRRiYDilNVLealnliekkekneirwkg 71 
                       +++++ e+a+    +++k ++RRiYDi+NVLe+++liekk kn+i+wkg
  Pd.00g971200.m01 680 QNLKILEAAHMW--KKQKVQKRRIYDITNVLEGIGLIEKKLKNRIQWKG 726
                       566666666666..56677****************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    
MASFKDADPT PGFLTRKDAD VMLPRPTRVK NKTPAPVQIT AEQILREARE RQEAEIRPPK  60
QKITDPTELA DYRLRKRKEF EDQIRRVKGN VGDWIKYAQW EESHKDFERA RSVWERALEV  120
DHRNPTLWCN YAEAEMKNKF INHARNVWDR AITLLPRVDK IWYKYIHMEE IIGNVAGARQ  180
IYERWMNWMP DQQGWLSFIK FELRYNEVER ARAIFERFVQ CHPKVGAWIR YAKFEMKNGE  240
VARARNVYER AVEIVGDDEE AEQLFVAFAE FEERCKETDR ARRIYKFALD HIPKERVEDL  300
YKKFVGLEKQ HGDRQGIEDA IVGKRRFQYE DEVRKNPLNY DSWFDYIRLE ESAGNKDRIR  360
EVYERAIANV PPVPEKRYWQ RYIYLWINYA LYEELDAGDM ERARDVYREC LQLIPHKKFS  420
FAKIWLLAAT FEIRQLNLEG ARKILGTAIG KSPKGKIFKK YIEIELNLGN FDRCRKLYGK  480
YLHWSPENCY AWTKYAELEK SLCETERTRA VFELAIAQPA LDMPELLWKA YIDFELSEGE  540
FERTRELYER LLDRTKHLKV WISYAKFEAS AIVEAMCSED QDQDYLREQT KQCVQRVRRI  600
FEKAFNYFRT SAPELKEERC LLLEEMLNAE ASFGDLGDVS LVQSKLPKKL KKRRPIPTED  660
GPAGYEEYID YCFPEEEHTQ NLKILEAAHM WKKQKVQKRR IYDITNVLEG IGLIEKKLKN  720
RIQWKGLDVS RTGDVDGNYP SLQAQFENLS DEER
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22220.22e-18E2F/DP family protein