PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g872490.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family EIL
Protein Properties Length: 244aa    MW: 26549.6 Da    PI: 4.2505
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g872490.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3936.4e-2915449102
                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3  49 msraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefd 102
                       m+raQD+iLkYM+k+mevc+ +GfvYgi+pekgkpv+g+sdsLr+WWk+k  + 
  Pd.00g872490.m01   1 MARAQDSILKYMVKIMEVCKGKGFVYGIVPEKGKPVTGSSDSLREWWKDKEDQK 54 
                       89**********************************************964332 PP

Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    
MARAQDSILK YMVKIMEVCK GKGFVYGIVP EKGKPVTGSS DSLREWWKDK EDQKESPSGL  60
SQIKGKNNGK WMCSLPSSEK GKSSIFDEEA WQNGQGLKSS ALGLGSVDKK SKVDHESALC  120
AYGDGQDQNN VSGLLAAGKF PLFDEFPIDT GVMSMVDWIN MELQKANQID QNSDALVING  180
QVGGEVSDTK VGDYGASYWG GGIEDLAIDG AFDIQMGSMD LNLCSEEEFS HNQESTSIWD  240
LGYD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.12e-25EIL family protein