PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g550600.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family EIL
Protein Properties Length: 622aa    MW: 70195.9 Da    PI: 5.0417
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g550600.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3504.26.6e-154504221353
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       +el+krmw+d+mllk+lke++k     ke+ ++++++++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lra
  Pd.00g550600.m01  50 DELEKRMWRDRMLLKKLKEQNKG----KER-VDNARQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRA 137
                       79******************998....777.89999********************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fdrngpaaiskyqa++ i++++++ +    s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e ww++l l
  Pd.00g550600.m01 138 WWKEKVRFDRNGPAAISKYQADHSIPGKDEDWSG-VASTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPTGNEVWWPQLNL 229
                       ***************************9999855.99******************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspkvtls 277
                       +kdqg+ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++ l+ +s ++ +s
  Pd.00g550600.m01 230 PKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARSLYPDrcPPLLTGGSGSFAIS 322
                       *****************************************************************************97778899******** PP

                       XXXXXXXX.XXXXXX.XXXXXXXXXX.........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXX CS
              EIN3 278 ceqkedve.gkkeskikhvqavktta.........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifa 344
                         +++dve  ++e++  +++ +k +                          + ++ +krk+  +e+ ++ + + ++tc+  q+++++++  f 
  Pd.00g550600.m01 323 GTSDYDVEgIDDEQN-VEIEDCKPHVnhfnigttgqrdrpvpqikgelieiNSDFGQKRKQLAEEPPIMLNPN-IYTCEYPQCPYHDYRRAFL 413
                       ********5455555.55777776667999******************************8777777777775.6****************** PP

                       XXXXXXXXX CS
              EIN3 345 dknsisqne 353
                       d +++++++
  Pd.00g550600.m01 414 DITARNNHQ 422
                       *******98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    
MGIFEEMGFC GELDFLSTTS GEGDSVDAAP EHEPEATVEE DYSDEEMDVD ELEKRMWRDR  60
MLLKKLKEQN KGKERVDNAR QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVSG ASDNLRAWWK EKVRFDRNGP AAISKYQADH SIPGKDEDWS GVASTPHTLQ  180
ELQDTTLGSL LSALMQHCDP PQRRFPLEKG VAPPWWPTGN EVWWPQLNLP KDQGPPPYKK  240
PHDLKKAWKV GVLTAVIKHM SPDIAKIRKL VRQSKCLQDK MTAKESATWL AIINQEEALA  300
RSLYPDRCPP LLTGGSGSFA ISGTSDYDVE GIDDEQNVEI EDCKPHVNHF NIGTTGQRDR  360
PVPQIKGELI EINSDFGQKR KQLAEEPPIM LNPNIYTCEY PQCPYHDYRR AFLDITARNN  420
HQLNCAYRTN SLQVFGMSSF QLNNEKPAVF SLPLGQPTQA VQQPVSQAGS FNASGFGLAD  480
DGQKMISELM SFYDSNIQQN KNSNPGNLNV VEGHNQQQAE FRFAMNDNFF GQGVDMGRNV  540
SEPTPMPVDM GRNMSETTPM PMHRQAFPSA EVQFDQCTIF DSPFGDNPND TVDLRFDSPL  600
HLAPADYNVL DPPKQDASFW FP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein