PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g199250.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family E2F/DP
Protein Properties Length: 853aa    MW: 101102 Da    PI: 8.1557
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g199250.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP51.12.2e-166807262371
           E2F_TDP  23 givtlnevakeLvsedvknkrRRiYDilNVLealnliekkekneirwkg 71 
                       +++++ e+a+    +++k ++RRiYDi+NVLe+++liekk kn+i+wkg
  Pd.00g199250.m01 680 QNLKILEAAHMW--KKQKVQKRRIYDIINVLEGIGLIEKKLKNRIQWKG 726
                       555666666655..56677****************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    
MASFKDADPT PGFLTRKDAD VMLPRPTRVK NKTPAPVQIT AEQILREARE RQEAEIRPPK  60
QKITDPTELA DYRLRKRKEF EDQIRRVKGN VGDWIKYAQW EESHKDFERA RSVWERALEV  120
DHRSPTLWCN YAEAEMKNKF INHARNVWDR AVTLLPRVDK IWYKYIHMEE IIGNVAGARQ  180
IYERWMNWMP DQQGWLSFIK FELRYNEVER ARAIFERFVQ CHPKVGAWIR YAKFEMKNGE  240
VARARNVYER AVEIMGDDEE AEQLFVAFAE FEERCKETDR ARRIYKFALD HTPKERVEDL  300
YKKFVGLEKQ HGNRQGIEDA IVGKRRFQYE DEVRKNPLNY DSWFDYIRLE ESAGNKDRIR  360
EVYERAIANV PHVPEKRYWQ RYIYLWINYA LYEELDAGDM ERARDVYREC LQLIPHKKFS  420
FAKIWLLAAT FEIRQLNLEG ARKILGTAIG KSPKGKIFKK YIEIELNLGN FDRCRKLYGK  480
YLHWSPENCY AWTKYAELEK SLCETERTRA VFELAIAQPA LDIPELLWKA YIDFELSEGE  540
FERTRELYER LLDRTKHLKV WISYAKFEAS AIVEAMCSED QDQDYLREQT KQCVQRVRRI  600
FEKAFNYFRT SAPELKEERC LLLEEMLNVE ASFGDLGDVS LVQSKLPKKL KKRRPILTKD  660
GPAGYEEYID YSFPEEEHTQ NLKILEAAHM WKKQKVQKRR IYDIINVLEG IGLIEKKLKN  720
RIQWKGLDVL RTGDVDGNYP SLQLLFCAEA IKLPREMQER LRDLSEDESN KKWLFVTKKT  780
SRAYLQGSDA DYWLLSDADI SITDMWRTEP GVVWNELGAI DEDYALVNVG TPRPQTPPSS  840
SIQVPATANR TKT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22220.32e-22E2F/DP family protein