PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g1265160.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family EIL
Protein Properties Length: 131aa    MW: 15272.6 Da    PI: 6.8056
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g1265160.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3138.11.3e-42291282105
                        XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
               EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                        elkkrmwkd m+l++ ke +k  +ed+e+++    +   +e++r+kkm+raQD+iLkYM+k+mevc+ +GfvYgi+pekgkpv+g+sdsLr+
  Pd.00g1265160.m01  29 ELKKRMWKDHMRLRKFKEDRKI-IEDEEEEA---HTLAKQEASRQKKMARAQDSILKYMVKIMEVCKGKGFVYGIVPEKGKPVTGSSDSLRE 116
                        9*************99999986.77777633...345789**************************************************** PP

                        XXXXXXXXXXXX CS
               EIN3  94 WWkekvefdrng 105
                        WWk+kv f+rn+
  Pd.00g1265160.m01 117 WWKDKVIFNRNA 128
                        **********86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    
MVEFHGEVAL GLGVLAEDEE ETEDISYGEL KKRMWKDHMR LRKFKEDRKI IEDEEEEAHT  60
LAKQEASRQK KMARAQDSIL KYMVKIMEVC KGKGFVYGIV PEKGKPVTGS SDSLREWWKD  120
KVIFNRNAQL P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.12e-40EIL family protein