PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pd.00g1018500.m01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family E2F/DP
Protein Properties Length: 125aa    MW: 14399.2 Da    PI: 5.2317
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pd.00g1018500.m01genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP26.51e-0884117235
            E2F_TDP   2 keksLrlltqkflkllekseegivtlnevakeLv 35 
                        +eksL lltq+f+kl+ +s+e++++l+ev+k L+
  Pd.00g1018500.m01  84 REKSLALLTQNFVKLFVCSTEEMISLDEVTKLLL 117
                        58*****************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    
MAYLFLHQPK NQYYWKGFGA IRNALQELRE EGLRENCINF VASDDAKVSD DKDDEERCGS  60
QLNDKSNPTV NPQPPADQKT DNIREKSLAL LTQNFVKLFV CSTEEMISLD EVTKLLLGMH  120
RVHQR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48160.14e-23E2F/DP family protein