PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW16241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 244aa    MW: 28324.5 Da    PI: 7.4604
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW16241genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.61.4e-101702081755
               HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               +  +k +yps+++++ LA+++gL+ +q+ +WF NrR ++
  OIW16241 170 NRHYKWPYPSESQKQALAESTGLDLKQINNWFINRRKRH 208
               4555789*****************************986 PP

2ELK39.51.2e-13128149122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK qLl+KYsgyLg+Lk+EF+
  OIW16241 128 ELKVQLLQKYSGYLGGLKKEFM 149
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    
MAHPLFPRLL SSYINCLKVG APPEVVARLE EICAKCDESS HYRTGNGSTG EDPSLDQFME  60
AYCEMLIKYE QELSKPFKEA MLFFSSVECQ LKALAVSTTD FGESGPSSQN RADIVHEHNM  120
NTQAEERELK VQLLQKYSGY LGGLKKEFMK KKKNGKLPKE ARQQLLEWWN RHYKWPYPSE  180
SQKQALAEST GLDLKQINNW FINRRKRHWK PSEDMQYAVM DATNYYMENV MCKPFPMDAM  240
PMLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-97TALE family protein