PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW15777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 790aa    MW: 88296.2 Da    PI: 7.4737
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW15777genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095986351954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  OIW15777 598 FEHflHPYPTDNDKHMLATQTGLSRNQVSNWFINARVR 635
               665559******************************87 PP

2BELL107.39.6e-35455523472
      BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               + q+kkakLl ++eeV  rYkqy++q+q+v+ssFe vagl sa+pY+slAlk iSrhFrcLk+ i++q+
  OIW15777 455 DYQQKKAKLLYMQEEVGWRYKQYHHQMQMVVSSFESVAGLSSATPYVSLALKSISRHFRCLKNLISDQL 523
               579***************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    
MSSSRLESHL AQQIRRDKLR IQDSSHHNLQ EFLNNNPGQS SLHPGFNLDQ VRNVRNASIL  60
VDEPVTGYSS SEMVNFSNPL SAPRNNNSLQ CQELGASEPA IKVMMHQFPS SSISLGNWRN  120
SATHQGVDWN VLNYASSSMS SERNQNSFLA SEINNNVSSN YQHFGKPCFN ELTETQSSSL  180
SREIHKKLGV NVMHHNPSSS YQNALQDIVK SSASISACNG SDMASLMQQT GQNIWVSNAN  240
ELAQLQPSYL NQQNQQSHFT CGNLWTNKPI PSDSTPQSLS LSLSSNSQSK PFVSHFEEAS  300
ASASAFASDH GISKDPPKHV KPTIISRDCG KSPLQDYVRI SPNSNSTSYQ NVGPLGPFTG  360
YATILKSSRF LNYAQQLLQE FCCVSDPRFA NAFDVPNRVS EEVSASTSTD AVIETRGVAP  420
KGGNLGSSSS MFYRANENIT ERVTESSFGF SPQPDYQQKK AKLLYMQEEV GWRYKQYHHQ  480
MQMVVSSFES VAGLSSATPY VSLALKSISR HFRCLKNLIS DQLKLISEVL GEDLSIPTTG  540
TSYKVDNNIT NPRSGDQRFQ KNKGIRNNKA LLEPQQHVWR PQRGLPEPAV AILKAWLFEH  600
FLHPYPTDND KHMLATQTGL SRNQVSNWFI NARVRVWKPM VEEIHMLETK GITSDNQNTN  660
ENERTEGGTR NPRMDKPLSK FGMYSIHESQ FQCMEMGSTI ADESGLNHEI QQWSQEKRSK  720
LEFRLSNNSS MHGSMTGFLP YRHRGGVEVE GLGSVSLTLG LRHGVEGVQN QQQLQEEQLI  780
HHFGGHIYDP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.15e-81TALE family protein