PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW15600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 584aa    MW: 65399 Da    PI: 5.5832
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW15600genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox309.1e-103944311954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   n+yp+ +e+  LA+++gLt +qV +WF N R +
  OIW15600 394 FEHflNPYPKDSEKIMLARQTGLTRNQVANWFINARVR 431
               665569******************************88 PP

2BELL1215.2e-39265336172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               erq+l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++v+g+g+a+pYt+lAl++iSrhFr+L dai++qi
  OIW15600 265 ERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVTGCGAAEPYTALALRTISRHFRSLHDAISGQI 336
               6899999****************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    
MYPNQSFSSG SFVEMLSQTP LLPHSYNESV GQNELKFITS IGDTVTMQTI DEHSNAEISN  60
PASNSFVGSR ESHVVPRTQF DSDQNIQCQG LSLSLGTVMM PPPFHYQYPD NGFSSLMTSS  120
PPNVKGNASV NDDVAGLKEL RNAECMASVS SGGFHNIIKR EGLYHPNSST CLSEGQSDSF  180
LHGSPGFPNT VLNSQYLRAA QELLDEIVSV RKALKETELE KRQSFCDIGL DGTKDDGKST  240
CQSMQVSSVL TGSTTNTSSE LSPAERQNLL DKKTKLLSML DEVDKRYRQY CHQMQIVVSS  300
FDMVTGCGAA EPYTALALRT ISRHFRSLHD AISGQIQVIQ RSLGEQEGIP RLRYVDQKLR  360
QQKALQQLGV MRQDWRPQRG LPESSVSILR AWLFEHFLNP YPKDSEKIML ARQTGLTRNQ  420
VANWFINARV RLWKPMIEDI YKEEFGDAEM INNNLSSENI PNKAPKVQES DNNNNMNNNG  480
PYSSAPITIK QNNDGCSLMV STTPATYDLS ELGNFSMGSH MSLALELRNC ERNEFGVSND  540
DIHRRNNETL VSSSETDLLD YHFTDPENQQ HKFGNPHLLH EFIV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-109TALE family protein