PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW15551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 383aa    MW: 44152.2 Da    PI: 6.5096
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW15551genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093093442055
               HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  OIW15551 309 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 344
               5679*****************************885 PP

2ELK36.21.3e-12264285122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK++Ll+KYsgyLgsLkqE+s
  OIW15551 264 ELKNHLLKKYSGYLGSLKQELS 285
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    
MEEYTNNNHL SENTDSSPRP NFLYSSLASG SGVGNHHHNH DHHEFPINTF HLQSDGGSYH  60
PHHCFQSNQV PPHCVVKTEA DSTNSQLHSP IFHYPLMRGN LHNNLMQQHQ GGSQISSNEV  120
EVIKAKIIAH PQYSNLLEAY MDCQKVGAPA EVVARLVAVR QEFEARQRSS VNSRETSKDP  180
ELDQFMEAYY DMLVKYREEL TRPVQEAMDF MRRIETQLNM LCNEPVRIFS DKYEGVGSSE  240
EEQDNNSGGE TELPGIDPQS EDRELKNHLL KKYSGYLGSL KQELSKKKKK GKLPKDARQK  300
LLNWWELHYK WPYPSESEKV ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFMVMDGLH  360
PQNAATLYMD GPYMSDGHYR LGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-142TALE family protein