PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW14935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 546aa    MW: 61549.9 Da    PI: 6.2296
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW14935genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.62.2e-084685061854
               HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               +F++  ++yp+ +e+  LA k gL+ +qV++WF N R +
  OIW14935 468 MFQNflHPYPKDAEKHLLAVKSGLSRSQVSNWFINARVR 506
               5887779******************************88 PP

2BELL68.99.1e-23338408172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +r++ ++kk++Ll ll+ Vd+rY+q+ ++++tv+s+F+a+++l++ ++++++Al+ iS  ++ ++++i+++i
  OIW14935 338 QRHAAESKKSQLLVLLQLVDDRYSQCLDEIHTVVSAFHAATELDP-QIHAHFALRMISILYKEMQERISSHI 408
               68999****************************************.***********************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    
METVIMYNAP MNIYVRDSSV IDEISQHSTS NPLIQSYSFV DLNNQTHIIN GISILAGEHG  60
EQPISNIISD VPFINHASIA NSSSLVTSQG KNVVGDSSNR INNTEYQEHL AAGMHITPVS  120
LAARIDLDES LDNSTVLPPS MGALEPYVFN NWQATSDPLS ETFQNHVYEK VPHRGYDEVT  180
GGNMWNNVNK FPKATEIVET VCQPYSSIGN MDPNGWTSNI SNLTNHAYNS SNFSNELSLS  240
LTTSRTAGQC SEASFPDVSS NRELAMGSTK YVQFSPLVLG SRYLVGIQQI LAQIARYSFE  300
DVEQMNGSSS AFPTMRSVLV NDKENSKFEE PHAESPLQRH AAESKKSQLL VLLQLVDDRY  360
SQCLDEIHTV VSAFHAATEL DPQIHAHFAL RMISILYKEM QERISSHILG MGSDFNKSCS  420
DENNDRCVET SFIQKQWALQ QLKRKNHQLW RPQRGLPERS VSVLRDWMFQ NFLHPYPKDA  480
EKHLLAVKSG LSRSQVSNWF INARVRLWKP MIDEMYAEMS QRKACRNEQG MESSHGNRRI  540
SMTHLN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-91TALE family protein