PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW14930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 374aa    MW: 42989.7 Da    PI: 6.3271
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW14930genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093073412155
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               k +yps++e+  LA+++gL+++q+ +WF N+R ++
  OIW14930 307 KWPYPSESEKVTLAESTGLDQKQINNWFINQRKRH 341
               669*****************************885 PP

2ELK37.93.9e-13261282122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK++LlrKYsgyL+sLkqE+s
  OIW14930 261 ELKNHLLRKYSGYLSSLKQELS 282
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    
MEEYTNNNNH IRENTGQVPR ENFLYTTAVG DSSGGNHHHH NQFPINTFHL QSGGSGHSFQ  60
PDQVRYDSNV KTESNNNTSQ QLQTPIFHYP LLRGSILQPH QTQHGGSHSS NEVEEDIKAK  120
IIAHPQYSNL LQVYMDCQKV GAPPEVVARM AAAQQDFEAR QRSSVRSNLE GSKDPELDQF  180
MEAYYDMLVK YRDELTRPIQ EAMDFMQKIE TQLNTLCNGN GPLRIFSDDK CEGVGSSEEE  240
QDNSDGETEL SVIDPQTEDR ELKNHLLRKY SGYLSSLKQE LSKKKKKGKL PKDARQKLLS  300
WWELHYKWPY PSESEKVTLA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF MVMDGLHPHN  360
AAVFMADGHY RLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-128TALE family protein