PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW14821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 576aa    MW: 64234.2 Da    PI: 5.1612
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW14821genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-093393761954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   n+yp+ +e+  LA+++gL+ +qV +WF N R +
  OIW14821 339 FEHflNPYPKDSEKVMLARQTGLSRNQVANWFINARVR 376
               665569******************************88 PP

2BELL119.31.8e-38210281172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               er++l  kk+kLl +l+eVd+rY+qy++q+q+v+ss ++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  OIW14821 210 ERKNLLDKKTKLLAMLDEVDRRYRQYCHQMQIVMSSLDMVAGCGAAEPYTTLALRTISRHFRCLRDAISSQI 281
               6788899****************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    
MYPNHQGFSS VSYADLLSGN SPLLPHNYSE AQNEVKFITA IGDTVTMQSI DGNVPRTQMG  60
IGDNTEQNVQ CQGLSLSLGT LMPSTESSVP SFQYHYPNNT GLSSIITDHD LIKREGLYNQ  120
HPSMQSDPCL QGSSGFSNNV LNSQYLKAAQ ELLDETVNVR NALSLNQHGA EKQENNFRGI  180
GLDGSKDSDG KSSGPNGSTA NPSCELSPEE RKNLLDKKTK LLAMLDEVDR RYRQYCHQMQ  240
IVMSSLDMVA GCGAAEPYTT LALRTISRHF RCLRDAISSQ IQMTQRSLGE QEGIPRLRYV  300
DQKLRQQKAL QQLGVMRQAW RPQRGLPETS VSILRAWLFE HFLNPYPKDS EKVMLARQTG  360
LSRNQVANWF INARVRLWKP MVEEMYKEEF GDSEMSCNVS SENTVLAKRD GVQASDNKWE  420
ESRDNLVTID DSVQQGQLDG LNPSTTELNR GIYEGENFNG NQSLGMNNTN TFYSSVPIPT  480
NQNGDDSVMA STNTPAAYDL SELGNFTVGG QVSLALELRN CENDGFSMSN DASNKRHNRP  540
ELASSSETDL LDYHFTESGK QQHRFGNPHL LHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-103TALE family protein