PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW14820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 440aa    MW: 50058.2 Da    PI: 6.0877
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW14820genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.8e-103634001954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +e+  LA+++gLt++qV++WF N R +
  OIW14820 363 FEHflHPYPNDSEKLMLASQTGLTKNQVSNWFINARVR 400
               664459******************************88 PP

2BELL109.32.2e-35225296172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               e+qe+q+k+ kL+ ll+eV+ rY++y++q++ v+ssFe++aglg+ak Yt lAl+a+SrhF +L+dai++qi
  OIW14820 225 EKQEHQMKIEKLIALLDEVESRYEKYYHQMEEVVSSFEMIAGLGAAKCYTVLALQAMSRHFCSLRDAIVSQI 296
               689********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    
MSHSITHQNQ YENPELDAYG SSLRNNSAYP EDLGVFPSTF QSIGDRMSLA EGSEMSHTRH  60
LMDLLGAANE RNHQTQGLSL SLSSHMLIPS DEYRHRPLNQ GLMNPNYFMH GQETREPCNN  120
AVEQHLSSEY FFTSGATFAS SSTSLNLSPS TSYGTESFAA VIGNSRYLKP AQSLLEDVIG  180
VGANVVDRMN EKYVEKLFHG SRTGARTLSS ELKAELRNMG PLLAEKQEHQ MKIEKLIALL  240
DEVESRYEKY YHQMEEVVSS FEMIAGLGAA KCYTVLALQA MSRHFCSLRD AIVSQINVEK  300
RKLFQDLPKI NSGLSQLTLF DRDNRQSRMS LQQLGIIHSQ RQVWRPIRGL PETSVTILRS  360
WLFEHFLHPY PNDSEKLMLA SQTGLTKNQV SNWFINARVR LWKPMIEDMY KEEFGDSSED  420
SNPQANNYLT REDTTYCVED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-104TALE family protein