PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW14007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 370aa    MW: 41692.4 Da    PI: 6.5895
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW14007genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092973302255
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +yps++++  LA+++gL+++q+ +WF N+R ++
  OIW14007 297 WPYPSESQKLALAESTGLDQKQINNWFINQRKRH 330
               58*****************************885 PP

2ELK41.13.8e-14250271122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK qLlrKYsgyLgsLkqEF+
  OIW14007 250 ELKGQLLRKYSGYLGSLKQEFM 271
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    
MEGGNSNGTS CLLPFGENSS GLYPMMMVPL VTSHHAGHHQ INPHNLNHNS SNNNTDSTIN  60
ANTNCLFLPM PSSSTNDHHH NPNSNNSGRN PSIMLENNHN TSANNNSNTG IGYYFMESDH  120
HHNNNNGSSS SSSSSVKAKI MAHPHYHRLL AAYVSCQKVG APPEVVARLE EACASAVAMA  180
GDTGGSACLG EDPALDQFME AYCEMLTKYE QELSKPLKEA MLFLQRERNG SYEEDVDVEN  240
IIDPEAEERE LKGQLLRKYS GYLGSLKQEF MKKRKKGKLP KEARLQLLDW WSRHYKWPYP  300
SESQKLALAE STGLDQKQIN NWFINQRKRH WKPSDEMPFY SNMVDPSHSQ YYMDNVLTHP  360
FPMDLSNTML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266275LKQEFMKKRK
2272276KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-117TALE family protein