PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW12034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 627aa    MW: 70037.8 Da    PI: 6.303
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW12034genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-094014381954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   n+yp+ +e+  LA+++gLt +qV +WF N R +
  OIW12034 401 FEHflNPYPKDSEKIMLARQTGLTRNQVANWFINARVR 438
               665569******************************88 PP

2BELL115.42.9e-37272343172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               erq+l  kk+kLls+l+eVdkrY+qy++ +q  +ssF++vag+g+a+pYt+lAl++iSrhFr+L+dai++qi
  OIW12034 272 ERQNLLDKKTKLLSMLDEVDKRYRQYCHHMQNAVSSFDMVAGCGAAEPYTALALHTISRHFRSLRDAISGQI 343
               6899999****************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    
MYTNQAFSSG SYVEMLSGTP LLPHNYNESV GAKNGFNFIT SISDTMTMHH IDGHSNAETS  60
DLACNSFVGA GDSHVVPRTQ FDRDQNVRGQ GLSLSLGTLM MPSIASVPHF QHQYPDNGFS  120
SLMTSSTPNM KGNASLNDDE VGLKELRNAE CMESVSSGGF HNSIRREGLY SPHPPICINE  180
GQSDPFLNGS SGFSNMILNS QYVKAAQELL DEIVNVQKAL KQTGLEKQPS FRDIGLDGSK  240
DYDAKSNSQS MQVTSGLSGS ITNTSSELSP AERQNLLDKK TKLLSMLDEV DKRYRQYCHH  300
MQNAVSSFDM VAGCGAAEPY TALALHTISR HFRSLRDAIS GQIQVTQRSL GEQEGIPRLR  360
YVDQKLRQQK ALQQLGVMRQ TWRPQRGLPE SSVSILRAWL FEHFLNPYPK DSEKIMLARQ  420
TGLTRNQVAN WFINARVRLW KPMVEDMYKE EFGDSEMSSN NLLPENIPNK APRVPKSDNK  480
REESHVQHGQ FHGMKFDHAS STTELEGGVE SHNDQRFNMN NSDPYSSAPI QINQNGDNCS  540
LMASTTPATY DLSELGNFSS GGRISLSLEL RNCERNEFVV SNDNMHKRSN ETLASSSDTD  600
LLDYHFTDPE KQQHKFSNSH LLHEFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-106TALE family protein