PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW11386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 693aa    MW: 75871.2 Da    PI: 6.8771
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW11386genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-094044411954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OIW11386 404 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 441
               554459******************************88 PP

2BELL1261.4e-40268339172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               erqe+q+kkakL+s+l+eVd+rY+qy++q+++v+ssFe+vag+gsa+ YtslAl++iS++FrcLkdai++qi
  OIW11386 268 ERQEIQMKKAKLISMLDEVDRRYRQYHHQMEIVVSSFEQVAGIGSARTYTSLALQTISKQFRCLKDAITGQI 339
               79*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    
MATYYHGNSE IQGGSADGLQ TLVLMNPGYI HYSDAPPQPP LSHAPTNLVF LNNNNNTNTN  60
NNFNPHAPQS HQTQHFVGVP LSSSAAAAAS QDLNHHHHSM HPHHDVSALH GFMPRMQYNL  120
WNSVDTNLAA REIPRSQQGL SLSLSSQQAG FGSFLVDREV PTQVQPPDIS GDDLGGSSPS  180
PASVVTNGGA SGIQSVVMSS KYLKAAHELL DEVVNVNNGI NTELAKKSGG GCGGGSKVIG  240
ESSGGAASGD GGSIGGEGGG KRELSTVERQ EIQMKKAKLI SMLDEVDRRY RQYHHQMEIV  300
VSSFEQVAGI GSARTYTSLA LQTISKQFRC LKDAITGQIR AANKSLGEED YFGGKSEGSR  360
LKYVDHHLRQ QRALQQLGLV QHNAWRPQRG LPERSVSVLR AWLFEHFLHP YPKDSDKHML  420
AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YMEEMKENEQ NNGSEDKSSK SNEDPSMKNT  480
ASLDKVPATE IEPKSFNPKQ QVSKSQNTPI AGESVRNQSG FSFNIGSSEL DGITQGSPKK  540
ARNHEIMHST NSVLSMNMDI KPNEQLSMKF GDERQGRDEY SFMGNQTNFI GGFGQYPIGD  600
IGRFDAEQFT PSFQGNGVSL TLGLDSLPGT HQNFLPNQNI QLGRSMDISE TNEFGAINTS  660
PSNSTAAFEN INMQNPKRFA AQLLPDFVAQ IRH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-149TALE family protein