PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW11099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 689aa    MW: 77997.4 Da    PI: 6.4567
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW11099genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.81.8e-084314681954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  OIW11099 431 FEHflHPYPSDIDKHILARQTGLSRSQVSNWFINARVR 468
               5544589*****************************88 PP

2BELL111.16.4e-36291361272
      BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               + elqk+k+kL+ +leeV +rYk+y++q+++v+ssFe+vag g+a++Y +lAlka+SrhF+cLkd i +qi
  OIW11099 291 FVELQKRKTKLILMLEEVGRRYKHYRNQMKAVVSSFEEVAGNGAATVYSALALKAMSRHFKCLKDEILGQI 361
               679******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    
MVSSSSAGYS YTDHVTPTHH LANQIQGFVS DSDIFNLTTN MEMIGFHKNQ LHQQQQQQCD  60
STNMWETNNF FSKLGPSTST NTMNESSTAF YEYSSNNNNN NKPDFISGIS ETTSNDNLII  120
GTTTHEDSAP WQDNTHNRLL VDDSSFRCVF PCEGNERPSQ GLSLSLSSTN PSNIGLQSFE  180
LRQTAQHHHR NQPDLGFFGK SQNVQLHHQQ QILQDGYLSA KAASVYQGHY FIKNSKYLVP  240
AQELLNEFCN LGTKQSDMVI KHKFSKNKQR EEDNNIDIGS SKKPTVTSLE FVELQKRKTK  300
LILMLEEVGR RYKHYRNQMK AVVSSFEEVA GNGAATVYSA LALKAMSRHF KCLKDEILGQ  360
IEATGKSMGE KDSVAVAPGA TRGETPRLKV IDQTLRQQRA FQQMTMMETH PWRPQRGLPQ  420
RSVSLLRAWL FEHFLHPYPS DIDKHILARQ TGLSRSQVSN WFINARVRLW KPMVEEMYIE  480
EVKEHENDMA NSLEGDTDPD IEDNVNPNNV QNQLHPSSII EEQKPTLRID TECVSSIINN  540
HNKNDPTKNM TKSLYYNQHH MNPGQDHLRI FSPNSVDTFG SMELDFSSYN HHHSSTMVPY  600
TTSNDQNANL GFSNDGGRSG VSLTLGLQQH GESGVSLAFP STTQHNSLFY TRDPNEDCQT  660
VEYSFLDGEG QNLQYRNLMG AQLLHDLAG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-134TALE family protein