PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW10983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 673aa    MW: 73563.3 Da    PI: 6.3621
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW10983genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.56e-104474841954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps ++++ LA+++gL+ +qV++WF N R +
  OIW10983 447 FEHflHPYPSDADKQLLARQTGLSRNQVSNWFINARVR 484
               664559******************************88 PP

2BELL93.22.5e-303243771871
      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
               +Vd+rY++y+eq+q+v++sF++v+g gsa pYt+lA+ka+SrhFrcLkdai+  
  OIW10983 324 KVDRRYNHYCEQMQMVVNSFDVVMGFGSAVPYTALAQKAMSRHFRCLKDAITAE 377
               7**************************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    
MSQDYQQGIF TFLNGFERTT VTHQDQHQEQ QIQRDKVRLQ EGFEPAPPPQ QLDGIEQQPG  60
GLPVYETAGM LSEMFNFSHD GATAAELLEQ QQQQMTVTFR SSRPEPVASG SEWYGSNRQG  120
IITGLGPLQD SSKNHHHSQI SSINVADSAA HQAMQLFLMN PQTRSPSPPP LPPTNSSSST  180
LHMLLPNTSS NPLQGYATGS TAGGSFGQFT WVPDHNTEDG SNTGGVVEGS MVHQGHQVGF  240
GTTSSSLNAV NVLRNSKYVK AAQELLEEFC SVGRGQFKKN KISRQNSNPN NSDTVGGGGG  300
SSKDPPPPIT SLSAADRIEH QRRKVDRRYN HYCEQMQMVV NSFDVVMGFG SAVPYTALAQ  360
KAMSRHFRCL KDAITAELKN SCEVLGEKDG GGCSGLTKGE TPRLKMLEQS LRQQRAFHQM  420
GMMEQEAWRP QRGLPERSVN ILRAWLFEHF LHPYPSDADK QLLARQTGLS RNQVSNWFIN  480
ARVRLWKPMV EDMYQQELKE REGDSEERED MNQSNNNSNS GQLAQTPNAA ATTSTATTAP  540
PPQPITGKRS DINAHESDPS LVAINREAFS ENQASTTIIN ASPSEVAPPV SQSFDSDLTH  600
HRSMATDDTC RHGSTVTGAD YGASFSVGGA DIGSTLIRFG TTAGDVSLTL GLRHAGNMPE  660
KTPPYSVRDY GAI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-146TALE family protein