PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW10801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 703aa    MW: 77658.1 Da    PI: 4.9803
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW10801genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.73.5e-076526852154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               + +yp+++++++L +++gL+ +q+ +WF N+R +
  OIW10801 652 NWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 685
               469*****************************87 PP

2ELK22.42.9e-08606627122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK  L++++++++ ++++E++
  OIW10801 606 ELKIDLKQGFKSKIEDVREEIM 627
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    
MGQLSIKCKE GIPKATEESK PTIIVRNEAG KILLNALLYP AIKTSLLKNS VVAIFHTLGN  60
AGGSGDNDSV VASTFLIRMK TEEDRNKLAS IIQEYAPEKL LSLVAEKHPV SLSESCADVS  120
GKGEKIHDQS TLRTSDHEVV DDSQGSIHNA DSDLFGVRFH QTDFSDAVPS SVNGSEPIYE  180
GEECVLDTRS QNFEDPESVY EGEVVLAEQA DKSTLAAPVL RADCEITPHQ GELIKTFLRN  240
NASQLTFTAT DQGYINQPDL VWEKLNEANG DTLFMTSNFK EFKAEESHES NTWDENNAMT  300
SAADFTGVPA AVDLACMRDT MNKLSGDSNK INPLVLVDLV IGHSVQVDMA RSENDVQAKK  360
DLVSSNVVQM HSITCSLVVF NTNGVLYPDS IVGSDSHTTM IDGLGVVGWR VGGIEANATM  420
LGQNNTISRF LMMGGGGDGG DHQHGELKAE IATHPLYEQV LAAHVACLRV ATPIDQLPLI  480
DAQLSQSHHL LRSYFSQQTH SLSPLNRQHL HNFLAQYLIV LCTFKEQLQQ HVRVHAVEAV  540
MACRDIENTL QALTGVSLGE GSGAAMSDDD EDELVMDLSL DDSHDIMGFG LPTESERSLM  600
ERVRQELKID LKQGFKSKIE DVREEIMRKR RAGKLPGDTT SVLKNWWQQH ANWPYPTEDD  660
KAKLVEETGL QLKQINNWFI NQRKRNWHSN SQSVTSLKSK RKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1683703RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-148TALE family protein