PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW10585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 354aa    MW: 40149.8 Da    PI: 4.762
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW10585genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-092973312155
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               k +yp+++++ +LAk +gL+ +q+ +WF N+R ++
  OIW10585 297 KWPYPTEADKIDLAKTTGLDPKQINNWFINQRKRH 331
               679*****************************885 PP

2ELK29.32e-10251272122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               +LK+ LlrK+++++g+Lk EFs
  OIW10585 251 DLKDKLLRKFGSHIGTLKLEFS 272
               69*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    
MEEMYGVPSS SMADYADKPI MTPENLIFPA DYHSFLMSSS SARIPMFGSD NLLSSAGIQR  60
QQEQQQDQYE VNTSTVMKAR IASHPHYPRL LQAYIDCQKV GAPPEIAGLL EEIQRENDLC  120
CKRNVVSTCF GADPELDHFM ETYCDMLVKY KSDLARPFDE ATSFLNSIEM QLSHLCTGAN  180
YVPTLNSDDG GVSSDEYFST GDGDVQDGQS RGEDNDLKDK LLHDGGVSSD EYFSTGDGDV  240
QDGQSRGEDN DLKDKLLRKF GSHIGTLKLE FSKKKKKGKL PKEARQTLLQ WWNLHYKWPY  300
PTEADKIDLA KTTGLDPKQI NNWFINQRKR HWKPSENMQF SMMENLTGRF QADE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-124TALE family protein