PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW09289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 313aa    MW: 35619.8 Da    PI: 6.6305
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW09289genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.5e-082622952154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp++e++++L +++gL+ +q+ +WF N+R +
  OIW09289 262 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 295
               469*****************************87 PP

2ELK28.14.8e-10216237122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OIW09289 216 ELKHELKHGYKEKIVDIREEIL 237
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    
MAYHNQNHDL SQQEFSLHHF TNQSNSTPNW LNNNTTTSTN TVSAAANSSA QWKAEILGHP  60
LYEQLLSAHV GCLRIATPVD QLPRIDAQLA QSEDVVAKYS NTFGPNMLGA HKELDQFMSH  120
YVLLLCSFKE QLQQHVRVHA MEAVMACWEI EQSLQTLTGV SPGEGTGATM SDDEDDQVES  180
DANIFDVSLD GTDNMGFGPL VPTENERSLM ERVRQELKHE LKHGYKEKIV DIREEILRKR  240
RAGKLPGDTT SVLKAWWQSH SKWPYPTEED KARLVQETGL QLKQINNWFI NQRKRNWHSN  300
ASTSTVLKSK RKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1293313RKRNWHSNASTSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-168TALE family protein