PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW09131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 738aa    MW: 82129.1 Da    PI: 7.2986
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW09131genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-095706071954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  OIW09131 570 FEHflHPYPTDNDKHMLATQTGLSRNQVSNWFINARVR 607
               665559******************************88 PP

2BELL106.91.3e-34429497472
      BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               + q+kkakLl ++e+V krYkqy++q+qt++ssFe vagl sa+pY+slAlk iS+hFrcLk+ i++q+
  OIW09131 429 DYQQKKAKLLFMQEKVGKRYKQYHQQMQTIVSSFESVAGLSSATPYVSLALKSISKHFRCLKNSISDQL 497
               579***************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    
MNNSRHESHV AQQIRRDKLR IQNSFHHLQE FPNNNPEQLS LHQGFDLDIQ VRNVRNANML  60
VDESAAVYSS EMAKISNPSP PPRNNNTLGY EELGEAEPIK LMMHQHGLVP HSYNSLGNEN  120
TFLASELNNN VFGYQHYAKQ SYNELTDTQS SLSREIQKQL GVNVMHHSSS SSSYQNALQD  180
IVKSSASIVV CNGSHTGSLI QQTSQNIWGG DPNELEQLQP SYANQPNHEP RFGSGNLWAN  240
RPHPSDSTPR SLSLSLSSNS QSKPSVSHFE EASASACISD HGISKHPPQY VKPSIISRNS  300
GKSPLQDYIV IPNPNPTSYR NVGPLGPFTG YATILKSSRF LNSAQQLLEE FYCVSHPRFA  360
NVFDLPKRVS GEVNASTSPS ADTVTINETE GFAPKGGNSG SSSSMFYSAN ENSTNRGSMS  420
SFGLSPIPDY QQKKAKLLFM QEKVGKRYKQ YHQQMQTIVS SFESVAGLSS ATPYVSLALK  480
SISKHFRCLK NSISDQLKHI TEVSGEDIPS TSTSSKVDTN TANPSCMDQS FQKNKVSRSN  540
MCLHEPQQHV WRPQRGLPEP AVAILKAWLF EHFLHPYPTD NDKHMLATQT GLSRNQVSNW  600
FINARVRLWK PMVEEIHMLE TKGTIGNNTS KNEGTSCTEG GRLDKPLSKF GMHSITESQF  660
QCNNAEENGT NDEEQWSQEK RSKLEFQMMG FVPYQSGGAL GSVSLTLGLR HGVEGAQNQQ  720
QLQEEQLIPH FGGHIYHH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.14e-83TALE family protein