PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW08540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 735aa    MW: 81745.7 Da    PI: 7.4403
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW08540genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-095615981954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OIW08540 561 FEHflHPYPSDTDKHMLASQTGLSRNQVSNWFINARVR 598
               665559******************************87 PP

2BELL87.31.7e-284284831772
      BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               ++V +rY+qy++q+q+v+ssFe vagl sa+pY+slAlk +SrhF+cLk+ i++q+
  OIW08540 428 NKVTRRYRQYHQQMQMVVSSFESVAGLSSATPYISLALKSVSRHFKCLKNGISNQV 483
               68***************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    
MSSLRPELHV AQQLRRDKLR IHETSSSQHQ HLQQEFPNNL EQYLSLHPEF NLDLLQARDI  60
NNNVRNANIL DEAPLYSSEV IPPHQYASFP HSSSTIIHSS PKQQCGNWMV NHGSTSSSVA  120
NQSNNLNSIL PFELNNNMST HQKHYDHKPS CNTNIVVTDA QSSSPSLYQN SLQDIFKSSS  180
ISGNTSEMAS LQENQGILGG NASESVLYHQ SYANQANMWT NQNSFNDKMI NGQQQQQQKH  240
GRNVFSDSKN PQGLSLSLSS NSLSNPCSQF EFDTQSLSGV SKHVKSFQES IPMGIPSNNT  300
THRNIGPLGP FTGYATILKC SRFLKPCQEL LDQLCSRCRG LSASTSADVD ENWVAEKRGI  360
SGASSFTLFY NSNEDTAADG GALRSFCISS RPECQMNKAN LLFMQEENSM ADTNPSYDLC  420
KCFALVHNKV TRRYRQYHQQ MQMVVSSFES VAGLSSATPY ISLALKSVSR HFKCLKNGIS  480
NQVKLVCEVL GEDSSIPTTS TTTSSGKFDT NIARLRCMDQ SSQKNKSGGS NMDIVESQQH  540
LWRPQRGLPD RAVTILKAWL FEHFLHPYPS DTDKHMLASQ TGLSRNQVSN WFINARVRVW  600
KPMVEEIHNL ETKGTTTGAN NNPSKNEGTS CVSEGSSSRK FGERGYSNDE HGNLEKRSKF  660
EMASSMEGTL MGFTPYRHGG GPYRHGGGGL GSVSLTLGLM HDVEGVQHQQ QQLQQEQEQQ  720
LRGHFGGHMI HDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.15e-72TALE family protein