PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW08463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 726aa    MW: 79691.2 Da    PI: 7.1828
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW08463genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-094214581954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OIW08463 421 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 458
               554459******************************88 PP

2BELL123.49e-40285356172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +rqelq+kk+kL+s+l+eV++rY++y++q+q+vissFe+vag+g+ak+Yt+lAlk+iS++FrcLkd i++qi
  OIW08463 285 QRQELQMKKSKLVSMLDEVEQRYRHYHHQMQIVISSFEQVAGYGAAKSYTALALKTISKQFRCLKDTISSQI 356
               69*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    
MATYFHGGSS SEIQSSAEGL QTLYLMNPNY VPYSDSPQHP TPNMFLINPN TAPTTTPHAL  60
NLANFSHAPP PQSPSNNNHN HHHQQQQHMI GVTIPSSSII GSTNDDEISG YHGLSSTASR  120
VQYNLWGFDQ NPSSAAAAVT IAATPPNSSG YATTATAATD ISPQVGFNRP NNHQQGLSLS  180
LSSQQPIYRS VSGEISPAIR GSGISGMNNS NVILGSKYLK AAQDLLDEVV NVGKGIFKGE  240
SIESTVNREK MKANIESTSG IGGDGSSGGE QNSGGKQGVE LSMAQRQELQ MKKSKLVSML  300
DEVEQRYRHY HHQMQIVISS FEQVAGYGAA KSYTALALKT ISKQFRCLKD TISSQIKATN  360
KTLGEDDCLG VKVEGSRLRY VDHHLRQQRT LQQLGMIQHN AWRPQRGLPE RAVSVLRAWL  420
FEHFLHPYPK DSDKVMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYLE EIKEQEQNNG  480
SKDNTNRAKE SNKELWTSAA NTAVQESSSG ANIRLDQNNV LQSKAESFNN NHNISPTEIS  540
NSNNSMGGST LQSQSSNFHI AGSSHDMQNS PNKRRNSEMH NSPGSGIFSV DMDMKPAETN  600
REISNTKFGI ENHGGGYGAF SIEDIGRFNN VTEQLAPRFH GNGVSLTLGL PHSENFPLSG  660
TQHEFLSQNI HLGGVGRLHE METNENEFCA INSTPPPSFH SGTSYESIDI QNRKRFAAQL  720
LRDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-120TALE family protein