PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW07504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 548aa    MW: 61212.8 Da    PI: 7.3521
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW07504genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-093774092254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               ++yp+ +++  LAk++gL+ +qV++WF N R +
  OIW07504 377 HPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 409
               79*****************************88 PP

2BELL108.73.6e-35237306372
      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +e +k+k kLl++l+eV++rYkqy++q+q+v+ sFe vaglg+a+pY+slA +a+S+hFrcLk+ai++qi
  OIW07504 237 NESRKQKPKLLTMLDEVYRRYKQYYQQMQAVVTSFEYVAGLGNAAPYASLAINAMSKHFRCLKNAITDQI 306
               688999***************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    
MAAEGFEPYH VPQQSRREKL RVLPHNQPTL LSESTSLFPL FDPSLVPSDL LTSPNQQGHM  60
MFHNNNILLS KENQGCNNGV MGFSRVVNAS SCSSSYLDPS IQVINNNPFL YNQPQSFQNL  120
SSSEMMMFKS EPLSLSLSSH INNNNNTQYP YGCGSNEVFS RNTVPLGPFT GYAMILKGSR  180
FLKPAQQLLE EVCGFGVHGI YTEKIAADAT LMEPPSMESL SAGGIVGVDD DAIGDGNESR  240
KQKPKLLTML DEVYRRYKQY YQQMQAVVTS FEYVAGLGNA APYASLAINA MSKHFRCLKN  300
AITDQIQFIN KTQFQVSNNR KDESPRFRNT NDRGGPYSHR PHGFLEHQQQ PVWRPQRGLP  360
ERAVSVLRAW LYDHFLHPYP TDTDKLMLAK QTGLSRSQVS NWFINARVRL WKPMVEEIHM  420
LESQQAQKSS QREEGSTNKS IHNHVASDRS SLVSHENPST STWNEFPNTS INHQVGIGGS  480
MGSVGNGISL TLGLHQNHGI GLSEPFPMNA AQRFGMTLDP EGCVLSSFES QNRLFGRDVI  540
GGQLLHDL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.14e-98TALE family protein