PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW05889
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 720aa    MW: 79246.4 Da    PI: 6.9756
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW05889genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-094234601954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OIW05889 423 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 460
               664459******************************88 PP

2BELL121.73e-39287358172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +rqe q+kk+kL+ +l+eV++rY++y++q+q+vissFe+vag+g ak+YtslAlk+iS++FrcLkdai++qi
  OIW05889 287 QRQEAQMKKSKLVGMLDEVEQRYRHYHHQMQIVISSFEQVAGYGGAKSYTSLALKTISKQFRCLKDAISSQI 358
               699********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    
MATYFHGSSS SEIQSSAEGL QTLYLMNPNY VPYSDAPQHP TPNMLFINPN TAPTTTSPPH  60
ALNLSNFTHA PPPPNNNHNL HHHHMTGATI PLSNTTGSTN TDEISSYHDF VAAAPRVHYN  120
MWGFDQTPWS AAAVTIAATP SNNSGYATNV SVAADISEQV GFHRPNNQQQ GLSLSLSSQQ  180
PEYRSLSGEI SAATRGSGIS SMNNNNNNNN NNNGILGSKY LKATHELLDE VVNVGKGIFK  240
GESINSVINK EKMKTDIEST SGIGGDGSSG GGQNSESKQG IELSTTQRQE AQMKKSKLVG  300
MLDEVEQRYR HYHHQMQIVI SSFEQVAGYG GAKSYTSLAL KTISKQFRCL KDAISSQIRA  360
TSKTLGEDDC LGVKVEGSRL RYVDHHLRQQ KTLQQLGMTQ HNAWRPQRGL PERAVSILRA  420
WLFEHFLHPY PKDSDKVMLA KQTGLTRSQV SNWFINARVR LWKPMVEEMY LEEVKEQEQN  480
HGSHDNTNRS KDQSNKEMKS LATINADALQ SKAESSFNNQ NTSQTEISNS NSLISTSPMG  540
VSTTLKSQSG NFHLAGSSHD MQNNPNKRRS SELHSSPGSG IFSVDMDMKP GETNREITNK  600
EFGIENHGSG GGYGAFSIED IGRFNNVTEN LAPRFDGNGV SLTLGLPRSE NFPLSGTQHE  660
FLSQNIHLGD DRIHEMGTNE NEFHAINSTP PSSHSGTSYE SIDLQNRKRF AAQLLRDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-122TALE family protein