PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW03412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 382aa    MW: 44248.2 Da    PI: 6.2379
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW03412genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65.1e-093083432055
               HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               +k +yps++e+  L++++gL+++q+ +WF N+R ++
  OIW03412 308 YKWPYPSESEKVALSESTGLDQKQINNWFINQRKRH 343
               5679*****************************885 PP

2ELK35.91.6e-12263284122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK++Ll+KYsgyL+sLkqE+s
  OIW03412 263 ELKNHLLKKYSGYLSSLKQELS 284
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    
MEEYTNTSNH MSENTGPSSS PRPNFLYSSL ASGSSLENHH HQFSINNFHL QSDSGSDHHH  60
HCFLYDQLPP QSAVKSEAPN STTSQLFTPI FNYPLMRGNF QKNTMQQYQG GSQSFNEVED  120
IKAKIIAHPQ YSNLIEAYLD CQKVGASSEV VTRLVETRQE FEARQRSSLN SRENSKDPEL  180
DQFMEAYYGM LVKYREELTR PVQEAMHFMR KIETQLNLLC NGPVWIFSAD KYEGIGSSEE  240
DQDNNSGGET ELPEFDPRSE DRELKNHLLK KYSGYLSSLK QELSKKKKKG KLPKDARQKL  300
LNWWELHYKW PYPSESEKVA LSESTGLDQK QINNWFINQR KRHWKPSEDM QFMVMDGLNP  360
QNGTTLYMDD VYMGDGHYRL AP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-125TALE family protein