PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIW01224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 290aa    MW: 32598.4 Da    PI: 9.7197
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIW01224genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-091131452254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               ++yp+ +++  LAk++gL+ +qV++WF N R +
  OIW01224 113 HPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 145
               79*****************************98 PP

2BELL57.34e-191433072
      BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
              +q+++ sFe v glg+a+pY+slA +a+S+hFrcLk++i+eq+
  OIW01224  1 MQAIVTSFEYVSGLGNAAPYASLAINAMSKHFRCLKNMITEQL 43
              9****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    
MQAIVTSFEY VSGLGNAAPY ASLAINAMSK HFRCLKNMIT EQLQFLNKTQ FQVSNNRKDE  60
SPRFRNTNDR GGPYSQRQPG FLEQQQPVWR PQRGLPERAV SVLRAWLYDH FLHPYPTDTD  120
KLMLAKQTGL SRSQVSNWFI NARVRLWKPM VEEIHMLESQ QQAQNKSQRD EHSRNKLIHN  180
HGSLVTHENP SSSTNRNDFL NTSNQQLGMH GSVNGASNGN GVSNGNGVSL TLGLHQNHGI  240
GLSEPFPMNA AQRFGLALDH EGCVISGFES QNRHFGRDVI GGQLLHDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-82TALE family protein