PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV99874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 356aa    MW: 40418 Da    PI: 6.3796
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV99874genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-072963282254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                +yp++e++++L +++gL+ +q+ +WF N+R +
  OIV99874 296 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 328
               59*****************************87 PP

2ELK29.12.2e-10249270122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OIV99874 249 ELKHELKQGYKEKIVDIREEIL 270
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    
MAYNEHLAFQ GFTEEEQELS PDESTRGGGG GGGGDMQQHH HHHRVVPPTW LINNNNATRQ  60
QQNFLHLQTQ KSMDRMSNSE SEELGEYKAH ILGHPLYDQL LSAHVSCLRI ATPVDQLPRI  120
DAQLQHSQRV VDKYSALANG VLDQKELDHF MTHYVLLLCA FKEQLQQHVR VHAMEAVMAC  180
WDLEQSLQSL TGVSPGEGSG ATMSDDEDEQ AESNANLYEG SMDGGDSLGF GPLVPTESER  240
SLMERVRHEL KHELKQGYKE KIVDIREEIL RKRRAGKLPG DTTSLLKAWW QSHSKWPYPT  300
EEDKARLVQE TGLQLKQINN WFINQRKRNW HTNPTTSTSS KSKRKSAGES SNQSFM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-159TALE family protein