PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV98390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family HB-PHD
Protein Properties Length: 708aa    MW: 81138.1 Da    PI: 8.5984
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV98390genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.48.7e-12489533953
               HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
  Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
               ++ +e L ++F++n  ps+++re L+k+lgL+ ++V  WF+N R+
  OIV98390 489 HDAVEKLRQVFAQNELPSRSMREALSKELGLDFAKVNKWFKNARY 533
               67899***************************************8 PP

2PHD38.82.1e-13228283151
               SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
       PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
               +C+ C+   +  e++++lCdg C+++fH+ Cl+++l++e++p +   w+C+ C++k
  OIV98390 228 FCANCKLreAFPENDIILCDGsCNRAFHQRCLDPPLDTENIPPEdqGWFCKFCECK 283
               699999954455********55*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    
MRGPRKCSHS KERTESKLDS SSRFDANNTK GRAKKNRLKS KLDKHRVGTN TSRMEVNNSS  60
IEGPIKDYSN KNLIIGQNLC KTDGKSSQMQ SSMMLHGKKA PLCSRNKGED IDREAKIHKM  120
KRRRKTKRRR DNVDLDDASR LQRRTRNLLI RMKQEQNLID AYSGEGWKGQ SREKIRPEKE  180
LQRATKQILK CKLSIRDAIR QLDSLSSVGS IEGSVIAPDG SVYHEHIFCA NCKLREAFPE  240
NDIILCDGSC NRAFHQRCLD PPLDTENIPP EDQGWFCKFC ECKIEILEAT NAHLGTQFSL  300
DITWQDVFKE EATLPDGDNA ILNQEEELPS DDPDDDDYNP ERREDSLSTN VKGTDDNASF  360
DSSSFASAWS LNSECSLVDE DIFREYCSVN SCIDSDDSGK IVCGHRKRKA VDYKKLHDEM  420
FGKDAPLFEQ VSEDEDWGPG KRKRREKESD AANTLMTLHE IENKYSNNDS IREGSSDRHN  480
KRPCFRIPHD AVEKLRQVFA QNELPSRSMR EALSKELGLD FAKVNKWFKN ARYTALKTRK  540
CQSEGEQLKS FTSKASKDFK SQNVEKDELL RSKASKISAV HCQKNGKNVA GREKIKSCRI  600
PLQERRQEKS NKILSKNENG DKDNEFSDDV CLKKLLKEKK RRVNSIYEGD FHAAELEFER  660
LSKVKYKLDS IKQRLSEVQN CRVKGSDESC SNESSVTYVP IAELREKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122127RRRKTK
2122131RRRKTKRRRD
3124133RRRKTKRRRD
4442447RKRREK
5636642LKEKKRR
6639667KKRRVNSIYEGDFHAAELEFERLSKVKYK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-148HB-PHD family protein