PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV97726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 415aa    MW: 47055.1 Da    PI: 6.6304
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV97726genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.6e-083633962154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp++e++++L +++gL+ +q+ +WF N+R +
  OIV97726 363 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 396
               469*****************************87 PP

2ELK28.82.7e-10317338122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OIV97726 317 ELKHELKQGYKEKIVDIREEIL 338
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    
MAYNNHNHHL SQNLPLHHFT DQQQQQPSTS NLTTKTVSHP NQPLQTAPTW LNNALLRTQY  60
NNNNNNNNNN VNNNNNNVNN NVNNNSDFLN LHTTPPSDSS TQWLSRSILH RNHSEVINDV  120
TVGESIIAGA GKESEAVEEG GGGEGLVNWE NGKYKAEILA HPLYEQLLSA HVSCLRIATP  180
VDQLPRIDAQ LGQSQNIVAK YSTFGHMLGH DNKELDQFLS HYVLLLCSFK EQLQQHVRVH  240
AMEAVMACWE IEQSLQSLTG VSPGEGTGAT MSDDEDNQVD SDADLFDGGL DGHDNMGFGP  300
LIPTENERSL MERVRHELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSVLKAWWQS  360
HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSPSTVLKN KRKRY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1394414RKRNWHSNPSPSTVLKNKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0TALE family protein