PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV97611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 443aa    MW: 50207.3 Da    PI: 5.9662
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV97611genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093654021954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +e+  LA++++Lt++qV++WF N R +
  OIV97611 365 FEHflHPYPNDSEKLMLASQTSLTKNQVSNWFINARVR 402
               554458******************************88 PP

2BELL110.41e-35227298172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               e+qe+q+k+akL+sll+eV+ rY++y++q++ v+ sFe++aglg+ak Yt++Al+a+SrhF +L+dai++qi
  OIV97611 227 EKQEHQMKIAKLISLLDEVESRYEKYYHQMEEVVQSFEMIAGLGAAKCYTAMALQAMSRHFCSLRDAIVSQI 298
               689********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    
MSNSITHQNQ YENQELDAYG SSLRNNNAYP LALGVFPSNI TSIGDRMSLT EGSEMSHTRH  60
LMDLLGAANE NNHQTQGLLS LSLGSHMLVP SDEYRHRPLN QGLMTPNYFM PGQETREACN  120
PAVEHHHITS DYFFTSGASF ASSSTSLNLS PSTSYETESF AGVISNSRYL KPSQSLLEDI  180
VGVGANVVDR MNEKYVEKLF HGSRTGARTL STELKTELGN IGPLLAEKQE HQMKIAKLIS  240
LLDEVESRYE KYYHQMEEVV QSFEMIAGLG AAKCYTAMAL QAMSRHFCSL RDAIVSQINV  300
EKRKLFHDLP KINSGLSQLS LFDRDNRQGR VSLQQLGIIQ SQRQVWRPIR GLPETSVVIL  360
RSWLFEHFLH PYPNDSEKLM LASQTSLTKN QVSNWFINAR VRLWKPMIEE MYKEEFGESS  420
EDSNPQANNY LTREEDTTYC VED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-103TALE family protein