PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV96470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 1043aa    MW: 117099 Da    PI: 5.0154
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV96470genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.93e-073323652154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp++e++++L +++gL+ +q+ +WF N+R +
  OIV96470 332 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 365
               469*****************************87 PP

2ELK27.47.8e-10286307122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OIV96470 286 ELKHELKQGYKEKIVDIREEIL 307
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1043 aa     Download sequence    
MAYQNHNHHF SQNLSLHHFT NQQQQQLASA PDLSNKPHSD PNHSLQTAPN WLNNALLRTQ  60
YDTNNHSEVM NVVTAGAGES IIAGVSHDSD ELKADTGAGR EKKEAAEDGG GEDGLVKWQN  120
GRYKAEIVAH PLYEELLSAH VSCLRIATPV DQLPRIDDQL AQSQNVVAKY SSFGNMIDDD  180
NKELDQFLSH YVLLLCSFKE QLQQHVRVHA MEAVMACWEI EQSLQSLTGV SPGEGTGATM  240
SDDEDDQVDS DINLLDGGLD GHDSMGFGPL IPTENERSLM ERVRHELKHE LKQGYKEKIV  300
DIREEILRKR RAGKLPGDTT SVLKAWWQSH SKWPYPTEED KARLVQETGL QLKQINNWFI  360
NQRKRNWHSN PSTSTVLKNK RKRLMTTFTL WEMTCKTDNR ANGNKSNRRV ISTILHETTQ  420
QEQSPNLEDC LKLLKGERDE QRLAGLLLVT KFCKAEDHSS LRRVYDAVGP RFLERLLRTG  480
MGKGTVTSGG DNNRDAYLCL SVTVLASFCR VPEIASLEDM VLKVPLILEA MSTRNGSSVL  540
EECYEFLYLV STASGNGIIK FYESGGIRIL ASQMSSMQDG SHLMEISIKL LQLILSRMSL  600
EIIQNDYSSE LLVIVAEIAK QFAVLHNSLK FDSLHLLNTM ISSKDSAQLL DALRLLPNDS  660
WSYYIRIGII AILQNRVATA ERLQALILAE SMVSISGEDW LISQVRTNDA QNPTPADMCL  720
LLVLEQSRVE IAVLLNELAY LKYKAPQDTS TTAEAIFSKR RNVAVAYSLV EKIIKLISNV  780
DENDGNLLDE CTLTKLICQL NETITVVLEY LEDARDHQQR KGDDLLASVR IIGSYLAEVP  840
IACEEKVRVL LGYMLSVEGE DEQSPFYSVC FLLPLLCQIT MELEGCKTLA SCGGHKAVLD  900
CLSKLIGSYD YIVEDKGCIF LACDTAMNLL LKKDKVQLML DELNFVDLLK ALVYWSENTD  960
DMSSMMMASS ICALIFDYTS EEALLNHPDF NYSTLSSLYQ LIVRCLASSG QDGNADMDLW  1020
DIVSAGFSRW ANRYPHIRES LNK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363383RKRNWHSNPSTSTVLKNKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-162TALE family protein