PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV94918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 689aa    MW: 77836.4 Da    PI: 6.7084
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV94918genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.8e-094264631954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  OIV94918 426 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 463
               554459******************************88 PP

2BELL117.75.6e-38288358272
      BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               + elqk+k+kLls+leeVd+rYk+y++q++ v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i +qi
  OIV94918 288 FIELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILGQI 358
               689******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    
MVSSSSAGFS YSDHVPPTHH LVNQIQGFVS DPDMFNLTSN MEMIGFHKNQ LDHHQQQEEC  60
DRTMWNKSNN FFSKPGPSTS NKTMNESCTS FYEYNNNNNN HKPDFTTGIS ETTSNENLII  120
GSTTHADSAP WQENRLMVDD SSLRCVFPCE GNERPSQGLS LSLSSTNPSS IGLQSFELRQ  180
TTQHHHQPQP GLGFFGKSHN VQQHQQQQIL QDAYLGAKAA SVYEGHFFIK DSKYLVPAQE  240
LLNEFCSLGT KQNEMVIKQK FNKNKQWEDD SNNGIGSSKK PTLTSLEFIE LQKRKTKLLS  300
MLEEVDRRYK HYRNQMKSVV SSFEAVAGNG AATVYSALAL KAMSRHFRCL KDGILGQIEA  360
TRKSMGEKDP IAPGTTRGET PRLKVIDQAL RQQRAFQQMT MMETHPWRPQ RGLPERSVSV  420
LRAWLFEHFL HPYPSDVDKH ILARQTGLSR SQVSNWFINA RVRLWKPMVE EMYIEEVKEH  480
ENNMLNSSGG NDDPDMEDNI NPNNVQNQLP SSSLLEDQKP ILQMDSVCAS SIINNHNTDN  540
NRNNPTKNNT KTLHHNHNMN PHDHVRLIEP NSTTDTFGSM ELDFSSYNHH HSSSGMVPYT  600
TSNEQNANHG FNGGIRASVV SLTLGLQQHG ESGVSLGFPS VTHQSSLLYT TRDQIEDCQT  660
IQYSLLDGEG QNLQYRNLMG AQLLHDLAG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-110TALE family protein