PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV93065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 276aa    MW: 31641.8 Da    PI: 6.8551
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV93065genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092262612055
               HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               +k +yp+++++ eLAk +gL+++q+ +WF N+R ++
  OIV93065 226 YKWPYPTETDKIELAKTTGLDQKQINNWFINQRKRH 261
               4679*****************************885 PP

2ELK32.42e-11181202122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK++LlrK+++++g+Lk EFs
  OIV93065 181 ELKNRLLRKFGSHIGTLKLEFS 202
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    
MEEMYGVPSS TTANYAEKHL ITPENLIFPP DYHSFLMSSS SSVRIPMFGS DDLLSAAVTS  60
SAAIQQQQRE QDQHEVHIST VMKAKIASHP HYPRLLQAYI DCQKENYCNM LVKYKSDLAR  120
PFDEATSFLN NMEMQLSHLC TGGANSVPTL NSDDGCVSSD EDFSIVEGDV QDGQLGSEDR  180
ELKNRLLRKF GSHIGTLKLE FSKKKKKGKL PKEAKQTLLQ WWNLHYKWPY PTETDKIELA  240
KTTGLDQKQI NNWFINQRKR HWKPSENMQF SMMETI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.19e-95TALE family protein