PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV92900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 759aa    MW: 83328.8 Da    PI: 7.1747
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV92900genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.8e-095535852254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               ++yps +++  L++++gL+ +qV++WF N R +
  OIV92900 553 HPYPSDADKHLLSRQTGLSRNQVSNWFINARVR 585
               89*****************************88 PP

2BELL925.9e-304254781871
      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
               +V++rY++y+eq+q+v++sF++v+g g+a pYt lA+ka+SrhFrcLkdai+ q
  OIV92900 425 KVERRYNHYCEQMQMVVNSFDIVMGFGAAIPYTGLAQKAMSRHFRCLKDAITAQ 478
               79**************************************************99 PP

Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    
MGIATTQPLP STILPHSKTH HSFFIFEDSP GESCSNSMSQ DNQHGIFTFS NGFERTTVTH  60
HDQQQQHQQE HQIRRDKVRL QQGFEPSLQL PPQPPLVVIE EEQGGLMPSG MLSEMFKFPH  120
GGATVAELLE QQQMTATLRS SRPQPVASGS ECYGSRQGII TTGLGPSADS TKNHYQNSSH  180
HHHHHSQISS INNAADIATH QAMQLFLMNP QTRSPSPPLP PSNPLQGFAT GSTAGDSFGQ  240
FTWITDHINE EGGTTGGVVE GQGLSLSLSS SLQHWEAAKA EELRMGESGF LYYNQGPGPG  300
GSSSSTQYPY KKIGGSHPHQ QSLHLHGAIV HQGHHVGFGS PSSSSLGIVN VMRNSKYVKA  360
AQELLEEFCS VGRGQFKKNK FSKQNSNPND LNTGGGGPSN SPSSKDPLPP TTLSAADRIE  420
HQRRKVERRY NHYCEQMQMV VNSFDIVMGF GAAIPYTGLA QKAMSRHFRC LKDAITAQMK  480
HSCEVLGEKD GSGSSGLTKG ETPRLKMLEQ SLRQQRVFNQ IGMMEQEAWR PQRGLPDRSV  540
NILRAWLFDH FLHPYPSDAD KHLLSRQTGL SRNQVSNWFI NARVRLWKPM VEDMYQQELK  600
EAEGSSEERE NMNQSNSGQL VQTSTATASP PPTICKRSDI NAHENDPSVV AINRKTLSEN  660
QPIKQCSSST TTTTIMTPPS EVAPPVSQCF DSDLTPHRSM ATDEICHYGT AVSEGGADIG  720
SNLIRFGTIA GDVSLTLGLR HDGNMPQKTR FSVRDFGGI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-136TALE family protein