PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV92745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 284aa    MW: 32408.7 Da    PI: 7.007
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV92745genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.8e-072332662154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp+++++ +L +++gL+ +q+ +WF N+R +
  OIV92745 233 KWPYPTEDDKVKLVEETGLQLKQINNWFINQRKR 266
               469*****************************87 PP

2ELK25.62.9e-09187208122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK +L++++++++ ++++E++
  OIV92745 187 ELKIELKQGFKSRIEDVREEIL 208
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    
MQEANLLMMG GGGIGGDHQH RQVKAEIATH PLYEQLLAAH VACLRVATPI DQLPLIDAQL  60
SHSHNLLRSY FSQQTHSLSP HDRQDLDNFL AQYLIVLCTF KEQLQQHVRV HAVDAVMACR  120
DIENTLQALT GASLGEGSGA TMSDDEEDMR MDLSLDQSNG EGHDMMGFGP LLPTESERSL  180
MERVRQELKI ELKQGFKSRI EDVREEILRK RRAGKLPGDT TSVLKNWWQQ HAKWPYPTED  240
DKVKLVEETG LQLKQINNWF INQRKRNWHS NSQSVTSLKS KRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264284RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-165TALE family protein