PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV92280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 676aa    MW: 74474.5 Da    PI: 6.6415
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV92280genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094004371954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OIV92280 400 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 437
               554459******************************88 PP

2BELL120.76.2e-39264335172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               erqe+q+kkakL+s+l+eV++rY+qy++q+++v+ssFe++ag++sa+ YtslAl++iSr+FrcLkdai+ qi
  OIV92280 264 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMEIVVSSFEQAAGIESARTYTSLALQTISRQFRCLKDAITCQI 335
               79*******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    
MGTYYHGNSE IQGASADGLQ TLVLMNPGYI HYSDAPPQTP LSHSPSNLVF LNNNNNNNFN  60
PHAPPPPSHH TQQFVGIPLS ATAASSQDLN HHSLHPHHHD VSALHGFMSP RMQYNLWNTI  120
DPNSTARETP RAQQGLSLSL SSQQAGFGSF LVDRDIPPTQ GQATAMSSDD IRGGSPSPGT  180
MNGGATSIQS VLLSSKYLNA AHELLDEVVN VNNGINNELA KKSGGGGGGN KVVGECSGAV  240
SGEGGGSIGG ENSGKRSTDL SNAERQEIQM KKAKLISMLD EVEQRYRQYH HQMEIVVSSF  300
EQAAGIESAR TYTSLALQTI SRQFRCLKDA ITCQIRAANK SLGEEDCFGG KIEGSRLKYV  360
DNHLRQQRTL QQLGMIQHNA WRPQRGLPER SVSVLRAWLF EHFLHPYPKD SDKHMLAKQT  420
GLTRSQVSNW FINARVRLWK PMVEEMYMEE MKENEQNNGS DEKSSKSNED KGPSNENEPK  480
NFNPKHVSKS QNNPIVSVEE SVRNQSGLSF NIGSSELDGI TQQSPKKARN HEIMHSPNSV  540
PSMNIDIKPN EQISMKFGDE RQGRDEYSFM GNQTNFIGGF GQYPIGDIGR FDAEQFTPRF  600
QGNGVSLTLG LDSLPGTHQN FLPNQSIQLG RSMDISEPNE FGAINTSPSH SNAAFENINM  660
QNPKRFEAQL LPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-152TALE family protein