PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV91825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 383aa    MW: 43174.2 Da    PI: 6.3601
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV91825genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-093073431955
               HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +k +yps++++  LA+++gL+++q+ +WF N+R ++
  OIV91825 307 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 343
               45679*****************************885 PP

2ELK414e-14263284122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK +LlrKYsgyLgsLkqEF+
  OIV91825 263 ELKGHLLRKYSGYLGSLKQEFM 284
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    
MEGGSSNGTS CLMPFGENSG GLYPIMVMPL VTSNHGGHHP INPHNLNHNN SNNNFTTNGT  60
INENTNCLFP SMPSSTNDHQ HQNHNNSGGN PPLMLENNRN SNTGIGYYFM ESDHNNNNGS  120
SSSSSSADKA KIMAHPYYHR LLAAYVSCQK VGAPPDVVAR LEEACASAVA MAGDTAGSAC  180
LGEDPALDQF MEAYCEMLTK YEQELSKPLK EAMLFLQRIE FQFKNLTVSS SDLVCNEATE  240
RNGSSEEDVD LHNIIDPQVE DRELKGHLLR KYSGYLGSLK QEFMKKRKKG KLPKEARQQL  300
LEWWSRHYKW PYPSESQKLA LAESTGLDQK QINNWFINQR KRHWKPSEDM PFYSNMMDPN  360
HPQYYMDNVL SHPFPMDLSN TML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279288LKQEFMKKRK
2285289KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-123TALE family protein