PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV91121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family HB-PHD
Protein Properties Length: 1245aa    MW: 138960 Da    PI: 4.5897
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV91121genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox421.6e-138649101056
               HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++L + F++n+yp+++++e LA++lgLt rqV  WF N R   +
  OIV91121 864 AVVQRLYKSFKENQYPDRNTKETLAQELGLTIRQVDKWFGNSRWSFR 910
               56899**************************************8766 PP

2PHD37.84.2e-13517572151
               SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
       PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
               +C+ C++     +++++lCdg C++ fH+ Cl+++l +e++p+g   wlC+ C++k
  OIV91121 517 FCAKCQSkeLSMDNDIILCDGaCDRGFHQLCLDPPLLTENIPSGdeGWLCPGCNCK 572
               699****66556********66*********************9*9*******975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1245 aa     Download sequence    
MTSPTGNLTN HNEGTGEQMH NLDSGMEQSG LSEKTPQMGS ECSGSEKKVL GTALNNPLID  60
EKSNHVSDIL AENPVIQLPA PPQHDLEKSR QTGEGLCLQQ STSEQVPVHL SNDKSENKCQ  120
PFSQNVQHEL VQMSDAVTGF LVEDQVQSIS AQVPIHLSDD NSENKSQPFS QDVDNAFEEM  180
NNTATDFLVE DQTQSISAQV PDHLSDDKLK NTSQPLPQNV QNEFEEMKIA VTGSLVEDQT  240
LYIPAQVPIN LSNDESENKC QSFSQNELVE KSDAVTAILV EDQSQCIIGE VPVHLPNDKS  300
ENKSQLLSQD VQNELVQKSD AETGVIVDNQ TQTQANMSYV DPSFGDFAKS TTPARLRHKG  360
KGNSKLLKKK YMLRSIGSSD RSLRSRTQEK PKAPESSSTL VDVNNDGVKR KKRKKKSRRD  420
EGKIDEFSRI KAHLRYFLNR VSYEQSLIDA YSGEGWKGYS MEKLKPEKEL QRAKSAILRR  480
KSQIRDLFQN LDSLCAEGRL PESLFDSEGE IDSEDIFCAK CQSKELSMDN DIILCDGACD  540
RGFHQLCLDP PLLTENIPSG DEGWLCPGCN CKDDCLDLVN DSLGTRLALS DTWERVFPEA  600
AAGNSEDHDF ELPSDDSSDD YNPDVSQDEE VEGGESSSDE SQYASASEKL EDSHHEDPYL  660
GLPSEDSEDD DYNPNAPDRD NKVTEESSSS DFTSDSEDLA AIRKDNKSPG QGEDITSASL  720
DDFENSKNSS KQKCKVGKRP SLTDELSSLK ESDPGQEGCA HVSGKRNVER LDYKRLYDET  780
YKSDTSDDDE DWTATTGRKK KASGELTSVS PDGKVSNNSR PNPRRNLHQN RVVNTNNSPA  840
KSPEGSGKSS KPRFSASKKR LGEAVVQRLY KSFKENQYPD RNTKETLAQE LGLTIRQVDK  900
WFGNSRWSFR HSSTSAGGNA SRQATDTMAE NKGALGGEER DGELVSQEGN GEKSKTPSTR  960
KRKYMSEPQA SEIPTDVEIA GTVTPANAQE MQKVEIDEKD LKAAGAEVFF DGGRRGVRIH  1020
GWLIETRRNS ILNSSTVQQW EQKLETTHLP EMEALPPVEV PAAVKWKFRT KPSMQVILDY  1080
DYTFTTPYCE SGTIEIDKEL NGGEFSEENR NIHWEECKEQ IDVATLASKE PILFYDEVVL  1140
YEDELADNGV SLLSVKVRVM PSSWFLLLRF WLRVDGVLIR LRETRMHCVF GGSTKPTILR  1200
ETCWRESSCK GHPFDSDVYT DDPSIISQRL PIIMQRTQKL VIPQL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409415KRKKRKK
2410416KRKKRKK
3411415KKRKK
4411419KKRKKKSRR
5413420RKKKSRRD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-92HB-PHD family protein