PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIV89368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Family TALE
Protein Properties Length: 756aa    MW: 82539.3 Da    PI: 6.6903
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIV89368genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095345711954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OIV89368 534 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 571
               664459******************************88 PP

2BELL81.41.2e-264114631870
      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
               +Vd+rY+ y+eq+ t+++sF++v+glg+a  Yt+lA ka+SrhFrcLkdai+ 
  OIV89368 411 KVDRRYSYYCEQMLTIVNSFDMVMGLGAAVQYTELAKKAMSRHFRCLKDAITV 463
               7**************************************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    
MSQDYNQGIF NFSNRFERST SITHQEQHQQ HEQQPPQPPL VVGIEEVSGG LPVYENPGML  60
SEMFNFPSHA GATVTATELL EQQQQQMTAM FRSTTKPPPP VASDWYGNRQ GMITGLGPLL  120
GDANNHPNRD RNNDSTIVQH HHHHNNQEHR HQQQQMLNTN ADSAAAMQLF LMNPPQTRSP  180
SPAPTTTHSS TLHMLLPSTS LQGFPAGNSG EGSFGQFTWV PDGGALDGGT TSTHLNNNEI  240
GGGAVEGQGL SLSLSSSLQH LEAAKSEELR MGQSGFMYYN QGGGGPSSAA HYHYQNLGIP  300
HLQQELHIQG GLGQSHQGHV LFGSSSYSSL GAVNVLRNSN YANAAQELLE EFCSVGRGQF  360
KKNKYQRQLP NPNSNPGGGS GGAGVGVASS SLSKDFPPLS AADRIEHQRR KVDRRYSYYC  420
EQMLTIVNSF DMVMGLGAAV QYTELAKKAM SRHFRCLKDA ITVELKNSCE LLGEKDGAGT  480
SGVTKGETPR LKLLEQSLRQ QRAFQQMGMM EQEAWRPQRG LPERSVNILR AWLFEHFLHP  540
YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMVEDM YQQELKEAEG SAEERENNNQ  600
SSSNISGHQA QTPTTAPPTT TSTATAPQPT TSTATGKRSN INVTENDPSL TAINIHGISE  660
NQATWHSIST TTAEVAPPLL ESDLPPHNRS VPTDDTCPHN SLVTAEYGTA NSGGSDIRST  720
LIRFGTTTGD VSLTLGLRHA GNMPEKSPFI RDFGGI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-125TALE family protein