PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019163903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family EIL
Protein Properties Length: 544aa    MW: 62078.9 Da    PI: 5.9664
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019163903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3478.83.5e-146454111353
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     +el++r w+d+m+lkr+ke++k+    ke  ++  k+++s eqarrkkmsraQDgiLkYMlk+mevc+a+GfvYgiipekgkpv+gasd+Lr+WW
  XP_019163903.1  45 DELERRIWRDKMKLKRVKENRKS----KEGGVDGGKQRQSVEQARRKKMSRAQDGILKYMLKMMEVCKAEGFVYGIIPEKGKPVSGASDNLREWW 135
                     79******************998....7888999************************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgessl.qtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskd 189
                     k+kv+fdrngpaai+ky+ +n+i++   +  + ++   +hsl+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww+     kd
  XP_019163903.1 136 KDKVRFDRNGPAAIAKYEVENAIPGAIPEGgSGNQVGPPHSLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGNEDWWS----HKD 226
                     *********************999887766455677899*************************************************....9** PP

                     --.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.XXXXXXXXXXXXXXXXXX CS
            EIN3 190 qgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.slrkqspkvtlsceqked 283
                       +ppykkphdlkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++ + s+ ++s  +t+ +++++d
  XP_019163903.1 227 VAPPPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDRPfSSASGSGIFTVPDSTEYD 321
                     **************************************************************************6658888************** PP

                     XXXXXXXX.XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXX CS
            EIN3 284 vegkkeskikhvqavktta...........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisq 351
                     v++++++   +vq++k ++                           +f+++rkrk  p+++         +tc+  ++++se  l+f+d++s+++
  XP_019163903.1 322 VDVDHDEACFDVQEQKPKHlnffhmggverfqdtmavpqhnheiisNFDFTRKRK--PDNEPPR-----PYTCEFPRCPHSELGLGFQDRTSRDN 409
                     *****************99********************************9998..4444333.....489**********************9 PP

                     XX CS
            EIN3 352 ne 353
                     ++
  XP_019163903.1 410 HH 411
                     96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    
MMFDEMGFCG DFDLFSGPMK ECGVDSEQPV VDDDYSDEEE DIDVDELERR IWRDKMKLKR  60
VKENRKSKEG GVDGGKQRQS VEQARRKKMS RAQDGILKYM LKMMEVCKAE GFVYGIIPEK  120
GKPVSGASDN LREWWKDKVR FDRNGPAAIA KYEVENAIPG AIPEGGSGNQ VGPPHSLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVP PPWWPTGNED WWSHKDVAPP PYKKPHDLKK  240
AWKVGVLTAV IKHMFPDIAK IRKLVRQSKC LQDKMTAKES ATWLAIINQE EALARELYPD  300
RPFSSASGSG IFTVPDSTEY DVDVDHDEAC FDVQEQKPKH LNFFHMGGVE RFQDTMAVPQ  360
HNHEIISNFD FTRKRKPDNE PPRPYTCEFP RCPHSELGLG FQDRTSRDNH HLTCPHRTTN  420
SPPRFGVSNF HINQPFVQQP NLTSFDLSGL GGVPEDGQRM ISDLMTFYET NLHRNKNIQC  480
QNHSIMEANI FEDSNIPMTR CSSVFDQCNV NSFPFTFGSP FNLQNIDYAE GAAQDSMPKK  540
DVWY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein