PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019155618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family EIL
Protein Properties Length: 658aa    MW: 73510.2 Da    PI: 5.0979
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019155618.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3417.51.4e-127373501310
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel+krmwkd+++lkr+ker+k +    ++a ++ k +++++qa rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWW
  XP_019155618.1  37 EELEKRMWKDRIKLKRIKERQKVSA---QQASDKLKGKQPTDQATRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWW 128
                     8********************9865...4447899999********************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+a++ +  ++ ++     ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww+++ l++  
  XP_019155618.1 129 KEKVKFDKNGPAAIAKYEAECRARVEGVGN--LTGNSQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEEWWEKMDLPTGL 221
                     ******************999998877777..4799999************************************************99999777 PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.......XXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.......slrkqspkvtl 276
                       ppykkphdlkk+wkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++l vl++ee+++++ s +  ss         r+++++  +
  XP_019155618.1 222 T-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESSIWLGVLEREEALIHQPSGDngSSgiseaptRGRSEKKRPSV 315
                     6.*********************************************************************996633787887655668889999 PP

                     XXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXX CS
            EIN3 277 sceqkedvegkkeskikhvqavktta.gfpvvrkr 310
                     s+++++dv+g ++   + ++ ++  +  +++v k 
  XP_019155618.1 316 SNDSDYDVDGIDDGPGSVSSRDESGNqVLDAVPKS 350
                     99999****54444434444433333222222222 PP

Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    
MAVMDEIGVD SSDIEVDDIR CDNIAEKDVS DEEIEAEELE KRMWKDRIKL KRIKERQKVS  60
AQQASDKLKG KQPTDQATRK KMSRAQDGIL KYMLKLMEVC KVRGFVYGII PEKGKPVSGS  120
SDNIRAWWKE KVKFDKNGPA AIAKYEAECR ARVEGVGNLT GNSQSVLQDL QDATLGSLLS  180
SLMQHCDPPQ RKYPLEKGVP PPWWPTGNEE WWEKMDLPTG LTPPYKKPHD LKKMWKVGVL  240
TAVIKHMSPD IAKIRKLVRQ SKCLQDKMTA KESSIWLGVL EREEALIHQP SGDNGSSGIS  300
EAPTRGRSEK KRPSVSNDSD YDVDGIDDGP GSVSSRDESG NQVLDAVPKS RQIERPKRPK  360
RPKRAKPTPS VQETPPSLNL NDKEHGDEPG DPLPDINDSN TMLAVHSMNE NQKDGSQPVN  420
PLEKSGEGQS HLPSGESDHS IIPSANEVST QISGKRSSVY PMSQNCEIVP YESRPQLGAS  480
DCAIPHQIQD SQIFNGQQFP GTNDRPGSSM FHYGPLIPEM HHGSQYPDLH QSPLYQYYNP  540
STDFGPTRDE ERSRLAFNDL QMRPDNFGVH STVVQSTGND VNDYGKDPFQ NEQDRPVDVP  600
PMMTITDNFE PPVTSVSPDY TRLNSPISFG IDVPNAFDTD VESFLDEDLM TIMTFFAS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-166EIL family protein