PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_021670483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Micrandreae; Hevea
Family HB-PHD
Protein Properties Length: 980aa    MW: 107626 Da    PI: 5.0172
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_021670483.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.68.9e-138238641152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                      ++ L + F++n+yp+++++e LAk+lg+t rqV+ WF N R
  XP_021670483.1 823 VTQGLYKSFRENQYPNRTTKESLAKELGITFRQVTKWFENAR 864
                     67889***********************************99 PP

2PHD39.41.3e-13461516151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   +++++++lCd +C++ fH+ Cl ++l +e++p +   wlC+ C++k
  XP_021670483.1 461 FCAKCGAedLTADNDIILCDgTCDRGFHQFCLAPPLLKEDIPPDgeGWLCPGCDCK 516
                     6999*9977778********56*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    
MFKSELMGVS PSQINCHTKS YSCPKHSRPG ETPEYDVKCK CTEISEQRHW ITSETVQIEP  60
GDTITVVSQC GTSEALQQSS EDATKNTLAE NLDPPSEDAR KSGLTDKSLG PKLTAIDQKL  120
EFGSEDTRGG PSKEQYSLSS GIIQDQNALS AFTIDETLQQ LCADAAKNSL AKDLELPCEE  180
ASKSSQIGKS PCPKQSTSER TLEFSSDIAC CEPSLEKRKA CCDIVKGELV EISTTLSSCT  240
ATGHLEPSPV LVTYLGLAPD SEINIPDEKL RPPHDEVDKH SNLERSETPS KDAVSNSSQV  300
GRRVKTTAKS SRKKYILRSL VRSDRVLRSR SQEKSKSPDS SANLANVSSK IEKTTTNKKK  360
RQGKIIEADE YSKIRKHLRY LLNRMSYEQS LITAYSAEGW KGLSLEKLKP EKELQRATSE  420
IFRRKLNIRD LFQRIDSLCA EGKLPESLFD SEGQISSEDI FCAKCGAEDL TADNDIILCD  480
GTCDRGFHQF CLAPPLLKED IPPDGEGWLC PGCDCKVDCI ELLNDSQGTN ISISDSWEKV  540
FPEAAAAGQN PDQNFGLPSD DSDDNDYDPN RPEIGEKSPG NESSSDESCF TSASDELEAP  600
PGDKQHLGLP SDDSEDDDYN PDGPDLDENL VESSNSDFTS DSEGLAATLD DKELSGEDES  660
RVYIRPQGDI TREGSNHGGK QKQSLQSELL SILEPSPSQD GSVPISGKRN VERLDYKKLY  720
NETYGSISSD SSDDEDFTDT VGPRKRRKST EVAPATVNGD ASVTKTGKQD LKETEYTPKR  780
SCQQPNFENT SISPAKAHDG SSPSSSCGKT VGPSIYRRLG EAVTQGLYKS FRENQYPNRT  840
TKESLAKELG ITFRQVTKWF ENARWSFNHS SSMDVLVRKT SKMESPLPKT LGPKTISRDA  900
TCNGAQREES PKMQSAKLGS PEASKQKSKT SKSRKRKHTS DQTSSGTDSI TEKMVKLSAN  960
LPKVQEKQVG GRMTRSKSVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-120HB-PHD family protein