PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_021669772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Micrandreae; Hevea
Family HB-PHD
Protein Properties Length: 932aa    MW: 102749 Da    PI: 4.7145
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_021669772.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.59.6e-138238641152
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                      ++ L + F++n+yp+++++e LAk+lg+t rqV+ WF N R
  XP_021669772.1 823 VTQGLYKSFRENQYPNRTTKESLAKELGITFRQVTKWFENTR 864
                     67889***********************************99 PP

2PHD38.33.1e-13461516151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   +++++++lCd +C++ fH+ Cl ++l +e++p +   wlC+ C++k
  XP_021669772.1 461 FCAKCGAedLTADNDIILCDgTCDRGFHQFCLVPPLLKEDIPPDdeGWLCPGCDCK 516
                     6999*9977778********56*******************99999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 932 aa     Download sequence    
MFKSELMGVS PSQISCHTKS YSCPKHSRPG ETPEYDVECK CTEISEQRHW ITSETVQIEP  60
GDTVTVVSQC GTSEALQQSS EDATKNTLAE NLDPPSEDAR KSGLTDKSLG PKLTAIDQKL  120
EFGSEDTRSG PSKEQYSLSS GIIQDQNALS TFTIDETLQR LCADAAKNSL AKDLELPCEE  180
ASKSSQIGKS PCPKQSTSER TLEFSSDIAC CEPSLEKRKA CCDIVKGELV EISTTLSSCT  240
ATGHLEPPPV LVTYLGLAPD SEINIPDEKL RPPHDEVDKH SNLERSETPS KDAVSNSSQV  300
GRRVKTTAKS SRKKYILRSL VRSDRVLRSR SQEKSKSPDS SANLANVSSK IEKTVTNKKK  360
RQGKIIEADE YSKIRKHLRY MLNRMSYEQS LITAYSAEGW KGLSLDKLKP EKELQRAKAE  420
IFRRKLNIRD LFQRIDSLCA EGKLPESLFD SEGQISSEDI FCAKCGAEDL TADNDIILCD  480
GTCDRGFHQF CLVPPLLKED IPPDDEGWLC PGCDCKVDCI ELLNDSQGTN ISISDSWEKV  540
FPEAAAAGQN PDQNFGLPSD DSDDNDYDPN RPEIGEKSPG NESSSDESCF TSASDELEAP  600
PGDEQHLGLP SDDSEDDDYN PDGPDLDENL MESSNSDFTS DSEGLAATLD DNELSGEDES  660
RVYIRPQGDI TREGSNHGGK QKQSLQSELL SILEPSPSQD GSVPISGKRN VERLDYKKLY  720
NETYGSISSD SSDDEDFTDT VGPRKRRKST EVAPATVNGD ASVTKTGKQD LKETEYTPKR  780
SCQQPNFENT SISPAKAHDG SSPSSSCGKT VGPSIYRRLG EAVTQGLYKS FRENQYPNRT  840
TKESLAKELG ITFRQVTKWF ENTRWSFNHS SSMDVLVRKT SKMESPLPKR TSDQTSSRTD  900
SITEKMVKLS ANLPKVQEKQ VGGRMTRSKS VA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-127HB-PHD family protein